TRAPPC4 Antibody - middle region : FITC

TRAPPC4 Antibody - middle region : FITC
Artikelnummer
AVIARP56842_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC4

Key Reference: Gavin,A.C., (2002) Nature 415 (6868), 141-147

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 4

Protein Size: 219

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP56842_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56842_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51399
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×