TRIB3 Antibody - N-terminal region : FITC

TRIB3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57517_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TRIB3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tribbles homolog 3

Protein Size: 385

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57517_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57517_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Sheep (Ovine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57761
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×