TRIM15 Antibody - middle region : FITC

TRIM15 Antibody - middle region : FITC
Artikelnummer
AVIARP58130_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM15

Key Reference: Uchil,P.D., PLoS Pathog. 4 (2), E16 (2008)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 15

Protein Size: 465

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58130_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58130_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Rabbit, Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 89870
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×