Trim3 Antibody - N-terminal region : FITC

Trim3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57941_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Trim3 is probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation.

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 3

Protein Size: 744

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57941_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57941_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55992
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×