TRIM31 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase TRIM31

Protein Size: 425

Purification: Affinity Purified

• Artikelnummer: AVIARP57948_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57948_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11074
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin