TRIM31 Antibody - middle region : FITC

TRIM31 Antibody - middle region : FITC
Artikelnummer
AVIARP57948_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase TRIM31

Protein Size: 425

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57948_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57948_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11074
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×