TRIM49 Antibody - middle region : HRP

TRIM49 Antibody - middle region : HRP
Artikelnummer
AVIARP58057_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM49

Molecular Weight: 53

Peptide Sequence: Synthetic peptide located within the following region: VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 452

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58057_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58057_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57093
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×