TRMT13 Antibody - N-terminal region : HRP

TRMT13 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57328_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRM13

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA:m(4)X modification enzyme TRM13 homolog

Protein Size: 481

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57328_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57328_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54482
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×