TRMT6 Antibody - middle region : HRP

TRMT6 Antibody - middle region : HRP
Artikelnummer
AVIARP56780_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is similar to an uncharacterized protein from C. elegans. Although the function of the encoded protein is unknown, it shares weak sequence similarity to a region of S. cerevisiae translation initiation factor subunit Gcd10p.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRMT6

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6

Protein Size: 497

Purification: Affinity Purified

Subunit: TRM6
Mehr Informationen
Artikelnummer AVIARP56780_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56780_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51605
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×