TRPC4AP Antibody - middle region : FITC

TRPC4AP Antibody - middle region : FITC
Artikelnummer
AVIARP55313_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPC4AP

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short transient receptor potential channel 4-associated protein

Protein Size: 797

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55313_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55313_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26133
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×