TSKS Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the TSKS is highest in the testis and down-regulated in testicular cancer. The gene encoded TSKS is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSKS

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine kinase substrate

Protein Size: 592

Purification: Affinity Purified

• Artikelnummer: AVIARP53749_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53749_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 60385
• Wirt: Rabbit
• Konjugat: Conjugated, FITC