TSKS Antibody - N-terminal region : FITC

TSKS Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53748_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSKS

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine kinase substrate

Protein Size: 592

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53748_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53748_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 60385
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×