Uniprot: O14817
Gene Name: TSPAN4
Immunogen: Recombinant human TSPAN4
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 99%
Core Sequence: IDSYAQQDLKKGLHLYGTEGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQE
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 33%, Pig - 92%, Cynomolgus monkey - 93%
Alternative gene names: NAG2；TM4SF7
Alternative protein names: Tetraspanin-4; Tspan-4; Novel antigen 2; NAG-2; Transmembrane 4 superfamily member 7
Protein name: Tetraspanin 4
Clone No.: KAA338_8H11
Antigen Species: Human
Target Name: Tspan4
IHC Verification: succeed
IHC Dilution: 1:200
WB Verification: -
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: P10163PAGN
Cross reactivity: Not tested
Deutsch
English
