TSPYL4 Antibody - middle region : Biotin

TSPYL4 Antibody - middle region : Biotin
Artikelnummer
AVIARP55378_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPYL4

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific Y-encoded-like protein 4

Protein Size: 414

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55378_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55378_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23270
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×