TSSK2 Antibody - middle region : Biotin

TSSK2 Antibody - middle region : Biotin
Artikelnummer
AVIARP53819_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSSK2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: DHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine/threonine-protein kinase 2

Protein Size: 358

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53819_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53819_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23617
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×