TSSK2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSSK2

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-specific serine/threonine-protein kinase 2

Protein Size: 358

Purification: Affinity Purified

• Artikelnummer: AVIARP53818_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53818_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23617
• Wirt: Rabbit
• Konjugat: Conjugated, HRP