TTC12 Antibody - C-terminal region : HRP

TTC12 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53725_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TTC12

Key Reference: Yang,B.Z., (2007) Hum. Mol. Genet. 16 (23), 2844-2853

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tetratricopeptide repeat domain 12, isoform CRA_a EMBL EAW67210.1

Protein Size: 732

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53725_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53725_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54970
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×