TTC27 Antibody - N-terminal region : FITC

TTC27 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57019_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of TTC27 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC27

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetratricopeptide repeat protein 27

Protein Size: 843

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57019_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57019_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55622
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×