TUB Antibody - N-terminal region : HRP

TUB Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57909_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TUB functions in signal transduction from heterotrimeric G protein-coupled receptors. It could be involved in the hypothalamic regulation of body weight.This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUB

Key Reference: Snieder,H., (2008) Diabetologia 51 (1), 54-61

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubby protein homolog

Protein Size: 561

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57909_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57909_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7275
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×