Tuba8 Antibody - N-terminal region : Biotin

Tuba8 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57297_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin alpha-8 chain

Protein Size: 449

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57297_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57297_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 53857
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×