TUBA8 Antibody - N-terminal region : HRP

TUBA8 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57298_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA8

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin alpha-8 chain

Protein Size: 449

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57298_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57298_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51807
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×