TUBB Antibody - N-terminal region : FITC

TUBB Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55761_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBB

Key Reference: Wiesen,K.M., (2007) Cancer Lett. 257 (2), 227-235

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin beta chain

Protein Size: 444

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55761_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55761_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 203068
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×