TUBE1 Antibody - middle region : FITC

TUBE1 Antibody - middle region : FITC
Artikelnummer
AVIARP56868_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBE1

Key Reference: Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin epsilon chain

Protein Size: 475

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56868_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56868_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51175
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×