TUBG2 Antibody - middle region : Biotin

TUBG2 Antibody - middle region : Biotin
Artikelnummer
AVIARP55345_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBG2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin gamma-2 chain

Protein Size: 451

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55345_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55345_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27175
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×