TUSC1 Antibody - middle region : HRP

TUSC1 Antibody - middle region : HRP
Artikelnummer
AVIARP54383_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUSC1

Key Reference: Shan,Z., (2004) Oncogene 23 (39), 6612-6620

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor suppressor candidate gene 1 protein

Protein Size: 212

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54383_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54383_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286319
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×