TXN2 Antibody - middle region : Biotin

TXN2 Antibody - middle region : Biotin
Artikelnummer
AVIARP54910_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXN2

Key Reference: Benhar,M., (2008) Science 320 (5879), 1050-1054

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin, mitochondrial

Protein Size: 166

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54910_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54910_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 25828
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×