UBAC2 Antibody - middle region : FITC

UBAC2 Antibody - middle region : FITC
Artikelnummer
AVIARP55756_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific functin of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBAC2

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-associated domain-containing protein 2

Protein Size: 309

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55756_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55756_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 337867
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×