UBAC2 Antibody - middle region : HRP

UBAC2 Antibody - middle region : HRP
Artikelnummer
AVIARP55756_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific functin of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBAC2

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-associated domain-containing protein 2

Protein Size: 309

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55756_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55756_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 337867
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×