UBE2K Antibody - middle region : FITC

UBE2K Antibody - middle region : FITC
Artikelnummer
AVIARP58012_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2K

Key Reference: Christensen,D.E., (2007) Nat. Struct. Mol. Biol. 14 (10), 941-948

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-conjugating enzyme E2 K

Protein Size: 200

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58012_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58012_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3093
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×