UBE2O Antibody - middle region : FITC

UBE2O Antibody - middle region : FITC
Artikelnummer
AVIARP57583_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2O

Molecular Weight: 141kDa

Peptide Sequence: Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-conjugating enzyme E2 O

Protein Size: 1292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57583_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57583_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63893
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×