UBE2O Antibody - middle region : HRP

UBE2O Antibody - middle region : HRP
Artikelnummer
AVIARP57583_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2O

Molecular Weight: 141kDa

Peptide Sequence: Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-conjugating enzyme E2 O

Protein Size: 1292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57583_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57583_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63893
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×