UBE4B Antibody - N-terminal region : FITC

UBE4B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54552_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBE4B

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 146kDa

Peptide Sequence: Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin conjugation factor E4 B

Protein Size: 1302

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54552_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54552_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10277
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×