UBQLN3 Antibody - N-terminal region : HRP

UBQLN3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53722_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. UBQLN3 is specifically expressed in the testis, and proposed to regulate cell-cycle progression during spermatogenesis. This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This gene is specifically expressed in the testis, and proposed to regulate cell-cycle progression during spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBQLN3

Key Reference: Bulger,M., (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (26), 14560-14565

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquilin-3

Protein Size: 655

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53722_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53722_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50613
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×