UCHL5 Antibody - middle region : HRP

UCHL5 Antibody - middle region : HRP
Artikelnummer
AVIARP56797_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5

Key Reference: Qiu,X.B., (2006) EMBO J. 25 (24), 5742-5753

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L5

Protein Size: 329

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56797_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56797_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51377
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×