UCHL5IP Antibody - middle region : Biotin

UCHL5IP Antibody - middle region : Biotin
Artikelnummer
AVIARP56968_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Key Reference: Hahn,Y. Hum. Genet. 119 (1-2), 169-178 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 427

Purification: Affinity Purified

Subunit: 7
Mehr Informationen
Artikelnummer AVIARP56968_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56968_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55559
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×