UEVLD Antibody - middle region : FITC

UEVLD Antibody - middle region : FITC
Artikelnummer
AVIARP57194_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UEVLD is a possible negative regulator of polyubiquitination.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UEVLD

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-conjugating enzyme E2 variant 3 Ensembl ENSP00000379499

Protein Size: 379

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57194_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57194_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55293
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×