UEVLD Antibody - N-terminal region : HRP

UEVLD Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57193_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UEVLD is a possible negative regulator of polyubiquitination.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UEVLD

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-conjugating enzyme E2 variant 3 Ensembl ENSP00000379499

Protein Size: 379

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57193_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57193_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55293
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×