UFSP1 Antibody - C-terminal region : FITC

UFSP1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54444_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UFSP1

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inactive Ufm1-specific protease 1

Protein Size: 142

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54444_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54444_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 402682
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×