Urgcp Antibody - N-terminal region : HRP

Urgcp Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56287_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Urgcp may be involved in cell cycle progression through the regulation of cyclin D1 expression.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: YGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Up-regulator of cell proliferation

Protein Size: 883

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56287_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56287_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 72046
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×