Usp12 Antibody - N-terminal region : HRP

Usp12 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55811_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Usp12 is a deubiquitinating enzyme. It has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitination of monoubiquitinated FANCD2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Usp12

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 12

Protein Size: 370

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55811_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55811_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22217
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×