USP36 Antibody - N-terminal region : FITC

USP36 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57665_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM, Jan 2009]

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human USP36

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ubiquitin carboxyl-terminal hydrolase 36

Protein Size: 285

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57665_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57665_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57602
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×