Usp44 Antibody - N-terminal region : FITC

Usp44 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55361_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Usp44

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEESSHPVAFEVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Usp44 Ensembl ENSRNOP00000007465

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55361_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55361_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 314746
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×