Usp44 Antibody - N-terminal region : HRP

Usp44 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55361_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Usp44

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEESSHPVAFEVN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Usp44 Ensembl ENSRNOP00000007465

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55361_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55361_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 314746
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×