UVSSA Antibody - C-terminal region : HRP

UVSSA Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57482_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UVSSA

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UV-stimulated scaffold protein A

Protein Size: 709

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57482_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57482_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57654
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×