Vat1l Antibody - N-terminal region : FITC

Vat1l Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57489_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Vat1l

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptic vesicle membrane protein VAT-1 homolog-like

Protein Size: 417

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57489_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57489_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 270097
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×