VGLL1 Antibody - middle region : HRP

VGLL1 Antibody - middle region : HRP
Artikelnummer
AVIARP58041_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL1

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription cofactor vestigial-like protein 1

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58041_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58041_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51442
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×