VGLL3 Antibody - middle region : FITC

VGLL3 Antibody - middle region : FITC
Artikelnummer
AVIARP55341_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL3

Key Reference: Maeda,T., (2002) J. Biol. Chem. 277 (50), 48889-48898

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription cofactor vestigial-like protein 3

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55341_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55341_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 389136
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×