VGLL3 Antibody - middle region : HRP

VGLL3 Antibody - middle region : HRP
Artikelnummer
AVIARP55341_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL3

Key Reference: Maeda,T., (2002) J. Biol. Chem. 277 (50), 48889-48898

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription cofactor vestigial-like protein 3

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55341_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55341_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 389136
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×