VIPAR Antibody - middle region : Biotin

VIPAR Antibody - middle region : Biotin
Artikelnummer
AVIARP57586_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VIPAR

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-defective protein 39 homolog

Protein Size: 493

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57586_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57586_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63894
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×