VIPAS39 Antibody - middle region : HRP

VIPAS39 Antibody - middle region : HRP
Artikelnummer
AVIARP57585_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat LOC681989

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: spermatogenesis-defective protein 39 homolog

Protein Size: 460

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57585_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57585_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 681989
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×